Recombinant Human HESX1 protein, His-tagged
Cat.No. : | HESX1-2449H |
Product Overview : | Recombinant Human HESX1 protein(1-185 aa), fused to His tag, was expressed in E. coli. |
Availability | March 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-185 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MSPSLQEGAQLGENKPSTCSFSIERILGLDQKKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERASKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFNTNLLE |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | HESX1 HESX homeobox 1 [ Homo sapiens ] |
Official Symbol | HESX1 |
Synonyms | HESX1; HESX homeobox 1; homeobox, ES cell expressed 1; homeobox expressed in ES cells 1; ANF; RPX; hAnf; homeobox protein ANF; Rathke pouch homeobox; CPHD5; MGC138294; |
Gene ID | 8820 |
mRNA Refseq | NM_003865 |
Protein Refseq | NP_003856 |
MIM | 601802 |
UniProt ID | Q9UBX0 |
◆ Recombinant Proteins | ||
HESX1-8932Z | Recombinant Zebrafish HESX1 | +Inquiry |
HESX1-2449H | Recombinant Human HESX1 protein, His-tagged | +Inquiry |
HESX1-3522HF | Recombinant Full Length Human HESX1 Protein, GST-tagged | +Inquiry |
HESX1-13749H | Recombinant Human HESX1, GST-tagged | +Inquiry |
HESX1-6570C | Recombinant Chicken HESX1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HESX1-5579HCL | Recombinant Human HESX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HESX1 Products
Required fields are marked with *
My Review for All HESX1 Products
Required fields are marked with *
0
Inquiry Basket