Recombinant Full Length Human HESX1 Protein, GST-tagged

• Cat.No.: HESX1-3522HF
• Product Overview: Human HESX1 full-length ORF ( NP_003856.1, 1 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 185 amino acids
• Description: This gene encodes a conserved homeobox protein that is a transcriptional repressor in the developing forebrain and pituitary gland. Mutations in this gene are associated with septooptic dysplasia, HESX1-related growth hormone deficiency, and combined pituitary hormone deficiency. [provided by RefSeq
• Molecular Mass: 47.8 kDa
• AA Sequence: MSPSLQEGAQLGENKPSTCSFSIERILGLDQKKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERASKYENYFSASERLSLKRELSWYRGRRPRTAFTQNQIEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQFLMAKKNFNTNLLE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HESX1 HESX homeobox 1 [ Homo sapiens ]
• Official Symbol: HESX1
• Synonyms: HESX1; HESX homeobox 1; homeobox, ES cell expressed 1; homeobox expressed in ES cells 1; ANF; RPX; hAnf; homeobox protein ANF; Rathke pouch homeobox; CPHD5; MGC138294
• Gene ID: 8820
• mRNA Refseq: NM_003865
• Protein Refseq: NP_003856
• MIM: 601802
• UniProt ID: Q9UBX0