Recombinant Human HES4 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: HES4-2588H
• Product Overview: HES4 MS Standard C13 and N15-labeled recombinant protein (NP_001135939) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Transcriptional repressor. Binds DNA on N-box motifs: 5'-CACNAG-3'.
• Molecular Mass: 25.9 kDa
• AA Sequence: MAADTPGKPSASPMAGAPASASRTPDKPRSAAEHRKVGSRPGVRGATGGREGRGTQPVPDPQSSKPVMEKRRRARINESLAQLKTLILDALRKESSRHSKLEKADILEMTVRHLRSLRRVQVTAALSADPAVLGKYRAGFHECLAEVNRFLAGCEGVPADVRSRLLGHLAACLRQLGPSRRPASLSPAAPAEAPAPEVYAGRPLLPSLGGPFPLLAPPLLPGLTRALPAAPRAGPQGPGGPWRPWLRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: HES4 hes family bHLH transcription factor 4 [ Homo sapiens (human) ]
• Official Symbol: HES4
• Synonyms: HES4; hairy and enhancer of split 4 (Drosophila); transcription factor HES-4; bHLHb42; hHES4; bHLH factor Hes4; class B basic helix-loop-helix protein 42
• Gene ID: 57801
• mRNA Refseq: NM_001142467
• Protein Refseq: NP_001135939
• MIM: 608060
• UniProt ID: Q9HCC6