Recombinant Human HES4 Protein, GST-tagged

• Cat.No.: HES4-4704H
• Product Overview: Human HES4 full-length ORF ( NP_066993.1, 1 a.a. - 221 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: HES4 (Hes Family BHLH Transcription Factor 4) is a Protein Coding gene. GO annotations related to this gene include transcription factor binding and protein dimerization activity. An important paralog of this gene is HES1.
• Molecular Mass: 49.9 kDa
• AA Sequence: MAADTPGKPSASPMAGAPASASRTPDKPRSAAEHRKSSKPVMEKRRRARINESLAQLKTLILDALRKESSRHSKLEKADILEMTVRHLRSLRRVQVTAALSADPAVLGKYRAGFHECLAEVNRFLAGCEGVPADVRSRLLGHLAACLRQLGPSRRPASLSPAAPAEAPAPEVYAGRPLLPSLGGPFPLLAPPLLPGLTRALPAAPRAGPQGPGGPWRPWLR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HES4 hairy and enhancer of split 4 (Drosophila) [ Homo sapiens ]
• Official Symbol: HES4
• Synonyms: HES4; hairy and enhancer of split 4 (Drosophila); transcription factor HES-4; bHLHb42; hHES4; bHLH factor Hes4; class B basic helix-loop-helix protein 42
• Gene ID: 57801
• mRNA Refseq: NM_001142467
• Protein Refseq: NP_001135939
• MIM: 608060
• UniProt ID: Q9HCC6