Recombinant Human HES1

• Cat.No.: HES1-26539TH
• Product Overview: Recombinant fragment corresponding to amino acids 201-280 of Human Hes1 with a proprietary tag; Predicted MWt 34.91 kDa.

Specification

• Description: This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box.
• Protein length: 80 amino acids
• Molecular Weight: 34.910kDa inclusive of tags
• Source: Wheat germ
• Biological activity: useful for Antibody Production and Protein Array
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.31% GlutathioneNote: Glutathione is reduced
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: APCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN
• Sequence Similarities: Contains 1 basic helix-loop-helix (bHLH) domain.Contains 1 Orange domain.
• Tag: Non

Gene Information

• Gene Name: HES1 hairy and enhancer of split 1, (Drosophila) [ Homo sapiens ]
• Official Symbol: HES1
• Synonyms: HES1; hairy and enhancer of split 1, (Drosophila); hairy homolog (Drosophila) , HRY; transcription factor HES-1; bHLHb39; FLJ20408; HES 1; Hes1
• Gene ID: 3280
• mRNA Refseq: NM_005524
• Protein Refseq: NP_005515
• MIM: 139605
• Uniprot ID: Q14469
• Chromosome Location: 3q28-q29
• Pathway: ATF-2 transcription factor network, organism-specific biosystem; C-MYB transcription factor network, organism-specific biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem; Developmental Biology, organism-specific biosystem; Fanconi anemia pathway, organism-specific biosystem
• Function: DNA binding; N-box binding; RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; histone deacetylase binding; protein binding