Recombinant Human HES1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: HES1-500H
• Product Overview: HES1 MS Standard C13 and N15-labeled recombinant protein (NP_005515) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This protein belongs to the basic helix-loop-helix family of transcription factors. It is a transcriptional repressor of genes that require a bHLH protein for their transcription. The protein has a particular type of basic domain that contains a helix interrupting protein that binds to the N-box rather than the canonical E-box.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 29.4 kDa
• AA Sequence: MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: HES1 hes family bHLH transcription factor 1 [ Homo sapiens (human) ]
• Official Symbol: HES1
• Synonyms: HES1; hairy and enhancer of split 1, (Drosophila); hairy homolog (Drosophila), HRY; transcription factor HES-1; bHLHb39; FLJ20408; HES 1; Hes1; hairy homolog; hairy-like protein; class B basic helix-loop-helix protein 39; HHL; HRY; HES-1
• Gene ID: 3280
• mRNA Refseq: NM_005524
• Protein Refseq: NP_005515
• MIM: 139605
• UniProt ID: Q14469