Recombinant Human HERC5 Protein, GST-tagged

• Cat.No.: HERC5-4693H
• Product Overview: Human HERC5 partial ORF ( NP_057407, 915 a.a. - 1024 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene is a member of the HERC family of ubiquitin ligases and encodes a protein with a HECT domain and five RCC1 repeats. Pro-inflammatory cytokines upregulate expression of this gene in endothelial cells. The protein localizes to the cytoplasm and perinuclear region and functions as an interferon-induced E3 protein ligase that mediates ISGylation of protein targets. The gene lies in a cluster of HERC family genes on chromosome 4. [provided by RefSeq
• Molecular Mass: 37.84 kDa
• AA Sequence: YDWKTFEKNARYEPGYNSSHPTIVMFWKAFHKLTLEEKKKFLVFLTGTDRLQMKDLNNMKITFCCPESWNERDPIRALTCFSVLFLPKYSTMETVEEALQEAINNNRGFG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HERC5 HECT and RLD domain containing E3 ubiquitin protein ligase 5 [ Homo sapiens ]
• Official Symbol: HERC5
• Synonyms: HERC5; HECT and RLD domain containing E3 ubiquitin protein ligase 5; hect domain and RLD 5; E3 ISG15--protein ligase HERC5; CEB1; cyclin-E-binding protein 1; probable E3 ubiquitin-protein ligase HERC5; HECT domain and RCC1-like domain-containing protein 5; CEBP1
• Gene ID: 51191
• mRNA Refseq: NM_016323
• Protein Refseq: NP_057407
• MIM: 608242
• UniProt ID: Q9UII4