Recombinant Human HECTD3 Protein, GST-tagged

• Cat.No.: HECTD3-4679H
• Product Overview: Human HECTD3 full-length ORF ( AAH19105.1, 1 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene transfers ubiquitin from an E2 ubiquitin-conjugating enzyme to targeted substrates, leading to the degradation of those substrates. The encoded protein has been shown to transfer ubiquitin to TRIOBP to facilitate cell cycle progression, and to STX8. [provided by RefSeq, Dec 2012]
• Molecular Mass: 50.4 kDa
• AA Sequence: MEGMDKETFEFKFGKELTFTTVLSDQQVVELIPGGAGIVVGYGDRSRFIQLVQKARLEESKEQVAAMQAGLLKVVPQAVLDLLTWQELEKKVCGDPEVTVDALRKLTRFEDFEPSDSRVQYFWEALNNFTNEDRSRFLRFVTGRSRLPARIYIYPDKLGYETTDALPESSTCSSTLFLPHYASAKVCEEKLRYAAYNCVAIDTDMSPWEE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HECTD3 HECT domain containing E3 ubiquitin protein ligase 3 [ Homo sapiens ]
• Official Symbol: HECTD3
• Synonyms: HECTD3; HECT domain containing E3 ubiquitin protein ligase 3; HECT domain containing 3; E3 ubiquitin-protein ligase HECTD3; FLJ21156; HECT domain-containing protein 3; probable E3 ubiquitin-protein ligase HECTD3; RP11-69J16.1; FLJ31983; MGC161630
• Gene ID: 79654
• mRNA Refseq: NM_024602
• Protein Refseq: NP_078878
• UniProt ID: Q5T447