Recombinant Full Length Human HECTD3 Protein, GST-tagged
Cat.No. : | HECTD3-3461HF |
Product Overview : | Human HECTD3 full-length ORF ( AAH19105.1, 1 a.a. - 210 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 210 amino acids |
Description : | The protein encoded by this gene transfers ubiquitin from an E2 ubiquitin-conjugating enzyme to targeted substrates, leading to the degradation of those substrates. The encoded protein has been shown to transfer ubiquitin to TRIOBP to facilitate cell cycle progression, and to STX8. [provided by RefSeq, Dec 2012] |
Molecular Mass : | 50.4 kDa |
AA Sequence : | MEGMDKETFEFKFGKELTFTTVLSDQQVVELIPGGAGIVVGYGDRSRFIQLVQKARLEESKEQVAAMQAGLLKVVPQAVLDLLTWQELEKKVCGDPEVTVDALRKLTRFEDFEPSDSRVQYFWEALNNFTNEDRSRFLRFVTGRSRLPARIYIYPDKLGYETTDALPESSTCSSTLFLPHYASAKVCEEKLRYAAYNCVAIDTDMSPWEE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HECTD3 HECT domain containing E3 ubiquitin protein ligase 3 [ Homo sapiens ] |
Official Symbol | HECTD3 |
Synonyms | HECTD3; HECT domain containing E3 ubiquitin protein ligase 3; HECT domain containing 3; E3 ubiquitin-protein ligase HECTD3; FLJ21156; HECT domain-containing protein 3; probable E3 ubiquitin-protein ligase HECTD3; RP11-69J16.1; FLJ31983; MGC161630; |
Gene ID | 79654 |
mRNA Refseq | NM_024602 |
Protein Refseq | NP_078878 |
MIM | 618638 |
UniProt ID | Q5T447 |
◆ Recombinant Proteins | ||
HECTD3-4618Z | Recombinant Zebrafish HECTD3 | +Inquiry |
HECTD3-1883R | Recombinant Rhesus Macaque HECTD3 Protein, His (Fc)-Avi-tagged | +Inquiry |
HECTD3-3024H | Recombinant Human HECTD3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HECTD3-13727H | Recombinant Human HECTD3, GST-tagged | +Inquiry |
HECTD3-7562M | Recombinant Mouse HECTD3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HECTD3-5590HCL | Recombinant Human HECTD3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HECTD3 Products
Required fields are marked with *
My Review for All HECTD3 Products
Required fields are marked with *
0
Inquiry Basket