Recombinant Human HAND1 Protein, His tagged

• Cat.No.: HAND1-7171H
• Product Overview: Recombinant Human HAND1 Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E. coli
• Tag: His
• Protein Length: 1-215 aa
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4, 10% Glycerol
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSMNLVGSYAHHHHHHHPHPAHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGGPPPAAAAAATAYGPDARPGQSPGRLEALGGRLGRRKGSGPKKERRRTESINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQSGDPEAFKAELKKADGGRESKRKRELQQHEGFPPALGPVEKRIKGRTGWPQQVWALELNQ
• Endotoxin: <1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Concentration: 1 mg/mL by BCA

Gene Information

• Official Symbol: HAND1
• Synonyms: HAND1; heart and neural crest derivatives expressed 1; heart- and neural crest derivatives-expressed protein 1; bHLHa27; eHand; Hxt; Thing1; class A basic helix-loop-helix protein 27; extraembryonic tissues, heart, autonomic nervous system and neural crest derivatives-expressed protein 1
• Gene ID: 9421
• mRNA Refseq: NM_004821
• Protein Refseq: NP_004812
• MIM: 602406
• UniProt ID: O96004