Recombinant Human HDGF protein(71-150 aa), C-His-tagged
Cat.No. : | HDGF-2784H |
Product Overview : | Recombinant Human HDGF protein(P51858)(71-150 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 71-150 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | EKFGKPNKRKGFSEGLWEIENNPTVKASGYQSSQKKSCVEEPEPEPEAAEGDGDKKGNAEGSSDEEGKLVIDEPAKEKNE |
Gene Name | HDGF hepatoma-derived growth factor [ Homo sapiens ] |
Official Symbol | HDGF |
Synonyms | HDGF; hepatoma-derived growth factor; hepatoma derived growth factor (high mobility group protein 1 like); high mobility group protein 1 like; HMG1L2; HMG-1L2; high mobility group protein 1-like 2; FLJ96580; DKFZp686J1764; |
Gene ID | 3068 |
mRNA Refseq | NM_001126050 |
Protein Refseq | NP_001119522 |
MIM | 600339 |
UniProt ID | P51858 |
◆ Recombinant Proteins | ||
HDGF-001H | Recombinant Full Length Human HDGF Protein, His tagged | +Inquiry |
HDGF-2819R | Recombinant Rat HDGF Protein | +Inquiry |
HDGF-2474R | Recombinant Rat HDGF Protein, His (Fc)-Avi-tagged | +Inquiry |
HDGF-2277M | Recombinant Mouse HDGF Protein (1-237 aa), His-Myc-tagged | +Inquiry |
HDGF-2784H | Recombinant Human HDGF protein(71-150 aa), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HDGF-5598HCL | Recombinant Human HDGF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HDGF Products
Required fields are marked with *
My Review for All HDGF Products
Required fields are marked with *
0
Inquiry Basket