Recombinant Human HBEGF Protein, GST-tagged

• Cat.No.: HBEGF-4599H
• Product Overview: Human HBEGF full-length ORF ( AAH33097.1, 20 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: HBEGF (Heparin Binding EGF Like Growth Factor) is a Protein Coding gene. Diseases associated with HBEGF include Diphtheria and Urinary Tract Obstruction. Among its related pathways are RET signaling and ErbB signaling pathway. GO annotations related to this gene include growth factor activity and epidermal growth factor receptor binding. An important paralog of this gene is AREG.
• Molecular Mass: 46.53 kDa
• AA Sequence: LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDVENEEKVKLGMTNSH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HBEGF heparin-binding EGF-like growth factor [ Homo sapiens ]
• Official Symbol: HBEGF
• Synonyms: HBEGF; heparin-binding EGF-like growth factor; diphtheria toxin receptor (heparin binding epidermal growth factor like growth factor) , DTR, DTS, HEGFL; proheparin-binding EGF-like growth factor; Diphtheria toxin receptor (heparin binding EGF like growth factor); heparin binding epidermal growth factor; heparin-binding epidermal growth factor; diphtheria toxin receptor (heparin-binding EGF-like growth factor); diphtheria toxin receptor (heparin-binding epidermal growth factor-like growth factor); DTR; DTS; DTSF; HEGFL
• Gene ID: 1839
• mRNA Refseq: NM_001945
• Protein Refseq: NP_001936
• MIM: 126150
• UniProt ID: Q99075