Recombinant Full Length Human HBEGF Protein, GST-tagged

Cat.No. : HBEGF-3493HF
Product Overview : Human HBEGF full-length ORF ( AAH33097.1, 20 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 208 amino acids
Description : HBEGF (Heparin Binding EGF Like Growth Factor) is a Protein Coding gene. Diseases associated with HBEGF include Diphtheria and Urinary Tract Obstruction. Among its related pathways are RET signaling and ErbB signaling pathway. GO annotations related to this gene include growth factor activity and epidermal growth factor receptor binding. An important paralog of this gene is AREG.
Molecular Mass : 46.53 kDa
AA Sequence : LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLPVENRLYTYDHTTILAVVAVVLSSVCLLVIVGLLMFRYHRRGGYDVENEEKVKLGMTNSH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HBEGF heparin-binding EGF-like growth factor [ Homo sapiens ]
Official Symbol HBEGF
Synonyms HBEGF; heparin-binding EGF-like growth factor; diphtheria toxin receptor (heparin binding epidermal growth factor like growth factor) , DTR, DTS, HEGFL; proheparin-binding EGF-like growth factor; Diphtheria toxin receptor (heparin binding EGF like growth factor); heparin binding epidermal growth factor; heparin-binding epidermal growth factor; diphtheria toxin receptor (heparin-binding EGF-like growth factor); diphtheria toxin receptor (heparin-binding epidermal growth factor-like growth factor); DTR; DTS; DTSF; HEGFL;
Gene ID 1839
mRNA Refseq NM_001945
Protein Refseq NP_001936
MIM 126150
UniProt ID Q99075

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HBEGF Products

Required fields are marked with *

My Review for All HBEGF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon