Active Recombinant Human HBEGF Protein (86 aa)

• Cat.No.: HBEGF-385H
• Product Overview: Recombinant Human HB-EGF produced in E. coli cells is a polypeptide chain containing 86 amino acids. A fully biologically active molecule, rhHB-EGF has a molecular mass of 14 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.

Specification

• Description: Proheparin-binding EGF-like growth factor (HB-EGF), also known as DTR, DTS and HEGFL, is a member of the EGF family of mitogens. It is expressed in macrophages, monocytes, endothelial cells and muscle cells. HB-EGF signals through the EGF receptor to stimulate the proliferation of smooth muscle cells, epithelial cells and keratinocytes. Compared to EGF, HB-EGF binds to the EGF receptor with a higher affinity and has been shown to bemore mitogenic, likely due to its ability to bind to heparin and heparin sulfate proteoglycans. HB-EGF has also been reported to act as a diphtheria toxin receptor, mediating endocytosis of the bound toxin. Heparin-binding EGF-like growth factor has been shown to interact with NRD1, Zinc finger and BTB domain-containing protein 16 and BAG1.
• Source: E. coli
• Species: Human
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 0.75 ng/mL, measured in a cell proliferation assay using 3T3 cells.
• Molecular Mass: 14 kDa, observed by reducing SDS-PAGE.
• Protein length: 86
• AA Sequence: GDLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant Human Proheparin-binding EGF-like Growth Factor (HB-EGF), remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, human HB-EGF should be stable up to 1 week at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: HBEGF heparin-binding EGF-like growth factor [ Homo sapiens ]
• Official Symbol: HBEGF
• Synonyms: HBEGF; heparin-binding EGF-like growth factor; diphtheria toxin receptor (heparin binding epidermal growth factor like growth factor), DTR, DTS, HEGFL; proheparin-binding EGF-like growth factor; Diphtheria toxin receptor (heparin binding EGF like growth factor); heparin binding epidermal growth factor; heparin-binding epidermal growth factor; diphtheria toxin receptor (heparin-binding EGF-like growth factor); diphtheria toxin receptor (heparin-binding epidermal growth factor-like growth factor); DTR; DTS; DTSF; HEGFL
• Gene ID: 1839
• mRNA Refseq: NM_001945
• Protein Refseq: NP_001936
• MIM: 126150
• UniProt ID: Q99075