Recombinant Human HAVCR2 protein, T7/His-tagged

• Cat.No.: HAVCR2-175H
• Product Overview: Recombinant human TIM3 cDNA (22 – 202 aa, derived from BC063431) protein fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 22-202 a.a.
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHGNLYFQGGEFSEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVV LRTDERDVNYWTSRYWLNGDFRKGDVSLTIENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPAKVTPAPTRQR DFTAAFPRMLTTRGHGPAETQTLGSLPDINLTQISTLANELRDSRLANDLRDSGATIRIG
• Purity: >90% by SDS-PAGE.
• Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.

Gene Information

• Gene Name: HAVCR2 hepatitis A virus cellular receptor 2 [ Homo sapiens ]
• Official Symbol: HAVCR2
• Synonyms: HAVCR2; Tim 3; TIM3; TIMD3; kidney injury molecule-3; T-cell membrane protein 3; T cell immunoglobulin mucin 3; KIM-3; Tim-3; TIMD-3; HAVcr-2
• Gene ID: 84868
• mRNA Refseq: NM_032782
• Protein Refseq: NP_116171
• MIM: 606652
• UniProt ID: Q8TDQ0
• Chromosome Location: 5q34