Recombinant Human HAUS2 Protein, GST-tagged
Cat.No. : | HAUS2-5173H |
Product Overview : | Human CEP27 full-length ORF ( NP_060567.1, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a subunit of the augmin complex. The augmin complex plays a role in microtubule attachment to the kinetochore and central spindle formation. [provided by RefSeq, Apr 2016] |
Molecular Mass : | 53.3 kDa |
AA Sequence : | MAAANPWDPASAPNGAGLVLGHFIASGMVNQEMLNMSKKTVSCFVNFTRLQQITNIQAEIYQKNLEIELLKLEKDTADVVHPFFLAQKCHTLQSMNNHLEAVLKEKRSLRQRLLKPMCQENLPIEAVYHRYMVHLLELAVTFIERLETHLETIRNIPHLAANLKKMNQALAKMDILVTETEELAENILKWRKQQNEVSSCIPKILAEESYLYKHDIIMPPLPFTSKVHVQTINAK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HAUS2 HAUS augmin like complex subunit 2 [ Homo sapiens (human) ] |
Official Symbol | HAUS2 |
Synonyms | HAUS2; HAUS augmin like complex subunit 2; CEP27; C15orf25; HsT17025; HAUS augmin-like complex subunit 2; centrosomal protein 27kDa; centrosomal protein of 27 kDa |
Gene ID | 55142 |
mRNA Refseq | NM_001130447 |
Protein Refseq | NP_001123919 |
MIM | 613429 |
UniProt ID | Q9NVX0 |
◆ Recombinant Proteins | ||
HAUS2-3826HF | Recombinant Full Length Human HAUS2 Protein, GST-tagged | +Inquiry |
HAUS2-2038R | Recombinant Rhesus monkey HAUS2 Protein, His-tagged | +Inquiry |
HAUS2-5173H | Recombinant Human HAUS2 Protein, GST-tagged | +Inquiry |
HAUS2-7490M | Recombinant Mouse HAUS2 Protein | +Inquiry |
HAUS2-4451C | Recombinant Chicken HAUS2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
HAUS2-5629HCL | Recombinant Human HAUS2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HAUS2 Products
Required fields are marked with *
My Review for All HAUS2 Products
Required fields are marked with *
0
Inquiry Basket