Recombinant Human HARS2 Protein, GST-tagged

• Cat.No.: HARS2-4582H
• Product Overview: Human HARSL partial ORF ( NP_036340, 2 a.a. - 110 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene is an enzyme belonging to the class II family of aminoacyl-tRNA synthetases. Functioning in the synthesis of histidyl-transfer RNA, the enzyme plays an accessory role in the regulation of protein biosynthesis. The gene is located in a head-to-head orientation with HARS on chromosome five, where the homologous genes share a bidirectional promoter. [provided by RefSeq
• Molecular Mass: 37.73 kDa
• AA Sequence: PLLGLLPRRAWASLLSQLLRPPCASCTGAVRCQSQVAEAVLTSQLKAHQEKPNFIIKTPKGTRDLSPQHMVVREKILDLVISCFKRHGAKGMDTPAFELKETLTEKYGE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HARS2 histidyl-tRNA synthetase 2, mitochondrial (putative) [ Homo sapiens ]
• Official Symbol: HARS2
• Synonyms: HARS2; histidyl-tRNA synthetase 2, mitochondrial (putative); HARSL, histidyl tRNA synthetase like; probable histidine--tRNA ligase, mitochondrial; HARSR; histidine tRNA ligase 2; mitochondrial (putative); HO3; hisRS; HARS-related; histidine translase; histidine-tRNA ligase homolog; probable histidyl-tRNA synthetase, mitochondrial; histidine tRNA ligase 2, mitochondrial (putative); HARSL
• Gene ID: 23438
• mRNA Refseq: NM_012208
• Protein Refseq: NP_036340
• MIM: 600783
• UniProt ID: P49590