Recombinant Human HAPLN4 protein, His-tagged
Cat.No. : | HAPLN4-3017H |
Product Overview : | Recombinant Human HAPLN4 protein(Q86UW8)(30-402aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 30-402aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 43.7 kDa |
AA Sequence : | QRGRKKVVHVLEGESGSVVVQTAPGQVVSHRGGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFTDVFVALGPQHRAFGSYRGRAELQGDGPGDASLVLRNVTLQDYGRYECEVTNELEDDAGMVKLDLEGVVFPYHPRGGRYKLTFAEAQRACAEQDGILASAEQLHAAWRDGLDWCNAGWLRDGSVQYPVNRPREPCGGLGGTGSAGGGGDANGGLRNYGYRHNAEERYDAFCFTSNLPGRVFFLKPLRPVPFSGAARACAARGAAVAKVGQLFAAWKLQLLDRCTAGWLADGSARYPIVNPRARCGGRRPGVRSLGFPDATRRLFGVYCYRAPGAPDPAPGGWGWGWAGGGGWAGGARDPAAWTPLHV |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | HAPLN4 hyaluronan and proteoglycan link protein 4 [ Homo sapiens ] |
Official Symbol | HAPLN4 |
Synonyms | HAPLN4; hyaluronan and proteoglycan link protein 4; BRAL2; KIAA1926; brain link protein 2; |
Gene ID | 404037 |
mRNA Refseq | NM_023002 |
Protein Refseq | NP_075378 |
UniProt ID | Q86UW8 |
◆ Recombinant Proteins | ||
HAPLN4-4012Z | Recombinant Zebrafish HAPLN4 | +Inquiry |
HAPLN4-30131H | Recombinant Human HAPLN4 protein, GST-tagged | +Inquiry |
HAPLN4-7481M | Recombinant Mouse HAPLN4 Protein | +Inquiry |
HAPLN4-4578H | Recombinant Human HAPLN4 Protein, GST-tagged | +Inquiry |
HAPLN4-748H | Recombinant Human HAPLN4 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HAPLN4 Products
Required fields are marked with *
My Review for All HAPLN4 Products
Required fields are marked with *
0
Inquiry Basket