Recombinant Human HAPLN4 protein, GST-tagged
Cat.No. : | HAPLN4-30131H |
Product Overview : | Recombinant Human HAPLN4 (30-206 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Gln30-Leu206 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | QRGRKKVVHVLEGESGSVVVQTAPGQVVSHRGGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFTDVFVALGPQHRAFGSYRGRAELQGDGPGDASLVLRNVTLQDYGRYECEVTNELEDDAGMVKLDLEGVVFPYHPRGGRYKLTFAEAQRACAEQDGILASAEQLHAAWRDGL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | HAPLN4 hyaluronan and proteoglycan link protein 4 [ Homo sapiens ] |
Official Symbol | HAPLN4 |
Synonyms | HAPLN4; hyaluronan and proteoglycan link protein 4; BRAL2; KIAA1926; brain link protein 2; |
Gene ID | 404037 |
mRNA Refseq | NM_023002 |
Protein Refseq | NP_075378 |
UniProt ID | Q86UW8 |
◆ Recombinant Proteins | ||
HAPLN4-30131H | Recombinant Human HAPLN4 protein, GST-tagged | +Inquiry |
HAPLN4-3017H | Recombinant Human HAPLN4 protein, His-tagged | +Inquiry |
HAPLN4-13668H | Recombinant Human HAPLN4, GST-tagged | +Inquiry |
HAPLN4-4012Z | Recombinant Zebrafish HAPLN4 | +Inquiry |
HAPLN4-748H | Recombinant Human HAPLN4 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HAPLN4 Products
Required fields are marked with *
My Review for All HAPLN4 Products
Required fields are marked with *
0
Inquiry Basket