Recombinant Human HAPLN4 Protein, GST-tagged

• Cat.No.: HAPLN4-4578H
• Product Overview: Human HAPLN4 partial ORF ( NP_075378, 30 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: HAPLN4 (Hyaluronan And Proteoglycan Link Protein 4) is a Protein Coding gene. Among its related pathways are Phospholipase-C Pathway and ERK Signaling. GO annotations related to this gene include extracellular matrix structural constituent and hyaluronic acid binding. An important paralog of this gene is HAPLN1.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 37.29 kDa
• AA Sequence: QRGRKKVVHVLEGESGSVVVQTAPGQVVSHRGGTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFTDVFVALGPQHRAFGSYRGRAELQGDGPGDASLVLRNVT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HAPLN4 hyaluronan and proteoglycan link protein 4 [ Homo sapiens ]
• Official Symbol: HAPLN4
• Synonyms: HAPLN4; hyaluronan and proteoglycan link protein 4; BRAL2; KIAA1926; brain link protein 2
• Gene ID: 404037
• mRNA Refseq: NM_023002
• Protein Refseq: NP_075378
• UniProt ID: Q86UW8