Recombinant Human HAPLN1 Protein, GST-tagged

• Cat.No.: HAPLN1-4574H
• Product Overview: Human HAPLN1 full-length ORF ( AAH57808, 1 a.a. - 354 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: HAPLN1 (Hyaluronan And Proteoglycan Link Protein 1) is a Protein Coding gene. Diseases associated with HAPLN1 include Cerebral Creatine Deficiency Syndrome 3 and Cerebral Creatine Deficiency Syndrome 2. Among its related pathways are Phospholipase-C Pathway and ERK Signaling. GO annotations related to this gene include extracellular matrix structural constituent and hyaluronic acid binding. An important paralog of this gene is HAPLN3.
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 64.68 kDa
• AA Sequence: MKSLLLLVLISICWADHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDVAVQACLNDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HAPLN1 hyaluronan and proteoglycan link protein 1 [ Homo sapiens ]
• Official Symbol: HAPLN1
• Synonyms: HAPLN1; hyaluronan and proteoglycan link protein 1; cartilage linking protein 1 , CRTL1; Cartilage link protein; cartilage-link protein; proteoglycan link protein; cartilage linking protein 1; cartilage-linking protein 1; CRTL1
• Gene ID: 1404
• mRNA Refseq: NM_001884
• Protein Refseq: NP_001875
• MIM: 115435
• UniProt ID: P10915