Recombinant Human HAPLN1 protein, His-SUMO-tagged

• Cat.No.: HAPLN1-7544H
• Product Overview: Recombinant Human HAPLN1 protein(P10915)(16-354aa), fused with N-terminal His and SUMO tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: N-His-SUMO
• Protein length: 16-354aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 51.4 kDa
• AASequence: DHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTLEDYGRYKCEVIEGLEDDTVVVALDLQGVVFPYFPRLGRYNLNFHEAQQACLDQDAVIASFDQLYDAWRGGLDWCNAGWLSDGSVQYPITKPREPCGGQNTVPGVRNYGFWDKDKSRYDVFCFTSNFNGRFYYLIHPTKLTYDEAVQACLNDGAQIAKVGQIFAAWKILGYDRCDAGWLADGSVRYPISRPRRRCSPTEAAVRFVGFPDKKHKLYGVYCFRAYN
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: HAPLN1 hyaluronan and proteoglycan link protein 1 [ Homo sapiens ]
• Official Symbol: HAPLN1
• Synonyms: HAPLN1; hyaluronan and proteoglycan link protein 1; cartilage linking protein 1 , CRTL1; Cartilage link protein; cartilage-link protein; proteoglycan link protein; cartilage linking protein 1; cartilage-linking protein 1; CRTL1
• Gene ID: 1404
• mRNA Refseq: NM_001884
• Protein Refseq: NP_001875
• MIM: 115435
• UniProt ID: P10915