Recombinant Human HADH

• Cat.No.: HADH-27760TH
• Product Overview: Recombinant Full Length Human HADHSC produced in Saccharomyces cerevisiae; 314 amino acids, MWt 34.3 kDa. 25 kDa proprietary tag is attached.

Specification

• Description: This gene is a member of the 3-hydroxyacyl-CoA dehydrogenase gene family. The encoded protein functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. The human genome contains a related pseudogene of this gene on chromosome 15.
• Tissue specificity: Expressed in liver, kidney, pancreas, heart and skeletal muscle.
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
• Sequences of amino acids: MAFVTRQFMRSVSSSSTASASAKKIIVKHVTVIGGGLMGA GIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVA KKKFAENPKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAEHTIFASNTSSLQITSI ANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTF ESLVDFSKALGKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKF IVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGF YKYK
• Sequence Similarities: Belongs to the 3-hydroxyacyl-CoA dehydrogenase family.
• Tag: Non
• Full Length: Full L.

Gene Information

• Gene Name: HADH hydroxyacyl-CoA dehydrogenase [ Homo sapiens ]
• Official Symbol: HADH
• Synonyms: HADH; hydroxyacyl-CoA dehydrogenase; HADHSC, hydroxyacyl Coenzyme A dehydrogenase , L 3 hydroxyacyl Coenzyme A dehydrogenase, short chain; hydroxyacyl-coenzyme A dehydrogenase, mitochondrial; HADH1; SCHAD
• Gene ID: 3033
• mRNA Refseq: NM_001184705
• Protein Refseq: NP_001171634
• MIM: 601609
• Uniprot ID: Q16836
• Chromosome Location: 4q22-q26
• Pathway: Beta oxidation of butanoyl-CoA to acetyl-CoA, organism-specific biosystem; Beta oxidation of decanoyl-CoA to octanoyl-CoA-CoA, organism-specific biosystem; Beta oxidation of hexanoyl-CoA to butanoyl-CoA, organism-specific biosystem; Beta oxidation of lauroyl-CoA to decanoyl-CoA-CoA, organism-specific biosystem; Beta oxidation of octanoyl-CoA to hexanoyl-CoA, organism-specific biosystem
• Function: 3-hydroxyacyl-CoA dehydrogenase activity; NAD+ binding; coenzyme binding; nucleotide binding; oxidoreductase activity