Recombinant Human HABP2

• Cat.No.: HABP2-28753TH
• Product Overview: Recombinant fragment corresponding to amino acids 105-204 of Human HABP2 with an N terminal proprietary tag; Predicted MWt 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 100 amino acids
• Description: The protein encoded by this gene is an extracellular serine protease that binds hyaluronic acid and is involved in cell adhesion. The encoded protein is synthesized as a single chain, but then undergoes an autoproteolytic event to form the functional heterodimer. Further autoproteolysis leads to smaller, inactive peptides. This protease is known to cleave urinary plasminogen activator, coagulation factor VII, and the alpha and beta chains of fibrinogen, but not prothrombin, plasminogen, or the gamma chain of fibrinogen. Two transcript variants encoding different isoforms have been found for this gene.
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Ubiquitously expressed.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GNKCQKVQNTCKDNPCGRGQCLITQSPPYYRCVCKHPYTGPSCSQVVPVCRPNPCQNGATCSRHKRRSKFTCACPDQFKGKFCEIGSDDCYVGDGYSYRG
• Sequence Similarities: Belongs to the peptidase S1 family.Contains 3 EGF-like domains.Contains 1 kringle domain.Contains 1 peptidase S1 domain.

Gene Information

• Gene Name: HABP2 hyaluronan binding protein 2 [ Homo sapiens ]
• Official Symbol: HABP2
• Synonyms: HABP2; hyaluronan binding protein 2; hyaluronan-binding protein 2; factor VII activating protein; FSAP; HABP; HGFAL; PHBP; plasma hyaluronan binding protein
• Gene ID: 3026
• mRNA Refseq: NM_001177660
• Protein Refseq: NP_001171131
• MIM: 603924
• Uniprot ID: Q14520
• Chromosome Location: 10q25.3
• Function: glycosaminoglycan binding; peptidase activity; serine-type endopeptidase activity