Recombinant Human H3F3B Protein, His-tagged

• Cat.No.: H3F3B-1728H
• Product Overview: Recombinant Human H3F3B protein (3-136 aa) was expressed in E. coli with His tag.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 3-136 a.a.
• Form: Lyophilized from sterile PBS, normally 5 % - 8 % trehalose and mannitol are added as protectants before lyophilization.
• AA Sequence: RTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
• Purity: 90 %
• Storage: Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage

Gene Information

• Gene Name: H3F3B H3 histone, family 3B (H3.3B) [ Homo sapiens ]
• Official Symbol: H3F3B
• Synonyms: H3F3B; H3 histone, family 3B (H3.3B); histone H3.3; H3.3B; H3 histone, family 3A; H3F3A
• Gene ID: 3021
• mRNA Refseq: NM_005324
• Protein Refseq: NP_005315
• MIM: 601058
• UniProt ID: P84243