Recombinant Human H3F3B Protein, GST-tagged
Cat.No. : | H3F3B-1729H |
Product Overview : | Recombinant Human H3F3B protein (3-136 aa) was expressed in E. coli with GST tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 3-136 a.a. |
Form : | Lyophilized from sterile PBS, normally 5 % - 8 % trehalose and mannitol are added as protectants before lyophilization. |
AA Sequence : | RTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA |
Purity : | 85 % |
Storage : | Store for up to 12 months at -20 centigrade to -80 centigrade as lyophilized powder. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage |
Gene Name | H3F3B H3 histone, family 3B (H3.3B) [ Homo sapiens ] |
Official Symbol | H3F3B |
Synonyms | H3F3B; H3 histone, family 3B (H3.3B); histone H3.3; H3.3B; H3 histone, family 3A; H3F3A; |
Gene ID | 3021 |
mRNA Refseq | NM_005324 |
Protein Refseq | NP_005315 |
MIM | 601058 |
UniProt ID | P84243 |
◆ Recombinant Proteins | ||
H3F3B-4048M | Recombinant Mouse H3F3B Protein, His (Fc)-Avi-tagged | +Inquiry |
H3F3B-3411HF | Recombinant Full Length Human H3F3B Protein, GST-tagged | +Inquiry |
H3F3B-4543H | Recombinant Human H3F3B Protein, GST-tagged | +Inquiry |
H3F3B-1729H | Recombinant Human H3F3B Protein, GST-tagged | +Inquiry |
H3F3B-1728H | Recombinant Human H3F3B Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
H3F3B-5653HCL | Recombinant Human H3F3B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All H3F3B Products
Required fields are marked with *
My Review for All H3F3B Products
Required fields are marked with *
0
Inquiry Basket