Recombinant Human H2AFX protein

• Cat.No.: H2AFX-124H
• Product Overview: Recombinant human full-length, non-fusion H2AX protein was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNK KTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTSATVGPKAPSGGKKATQASQEY
• Purity: >90% by SDS-PAGE
• Applications: 1. Soluble protein which may be used as substrate for enzymatic assay.2. Active protein, for in vitro histone /DNA reconstitution assay.3. As Immunogen for specific antibody production.
• Storage: Keep at -20°C for long term storage. Product is stable at 4 °C for at least 7 days.

Gene Information

• Gene Name: H2AFX H2A histone family, member X [ Homo sapiens ]
• Official Symbol: H2AFX
• Synonyms: H2AFX; H2A histone family, member X; H2AX; histone H2A.x; H2AX histone; H2A.X; H2A/X
• Gene ID: 3014
• mRNA Refseq: NM_002105
• Protein Refseq: NP_002096
• MIM: 601772
• UniProt ID: P16104
• Chromosome Location: 11q23.3
• Pathway: ATM mediated phosphorylation of repair proteins, organism-specific biosystem; ATM mediated response to DNA double-strand break, organism-specific biosystem; Amyloids, organism-specific biosystem; Assembly of the RAD50-MRE11-NBS1 complex at DNA double-strand breaks, organism-specific biosystem; Cell Cycle, organism-specific biosystem; Chromosome Maintenance, organism-specific biosystem; DNA Repair, organism-specific biosystem
• Function: DNA binding; enzyme binding; histone binding; protein binding