Recombinant Human H2AFV protein, His-SUMO-tagged

• Cat.No.: H2AFV-4562H
• Product Overview: Recombinant Human H2AFV protein(Q71UI9)(1-128aa), fused to N-terminal His-SUMO tag, was expressed in E. coli

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-128aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 29.5 kDa
• AA Sequence: MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTA
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: H2AFV H2A histone family, member V [ Homo sapiens ]
• Official Symbol: H2AFV
• Synonyms: H2AFV; H2A histone family, member V; H2AV; histone H2A.V; MGC1947; MGC10170; MGC10831; H2A.F/Z; histone H2A.F/Z; purine-rich binding element protein B; FLJ26479
• Gene ID: 94239
• mRNA Refseq: NM_012412
• Protein Refseq: NP_036544
• UniProt ID: Q71UI9