Recombinant Human H2AFV Protein, GST-tagged

• Cat.No.: H2AFV-4536H
• Product Overview: Human H2AFV full-length ORF ( AAH00098, 1 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a member of the histone H2A family. Several transcript variants encoding different isoforms, have been identified for this gene. [provided by RefSeq
• Molecular Mass: 39.82 kDa
• AA Sequence: MAGGKAGRDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIGKKGQQKTA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: H2AFV H2A histone family, member V [ Homo sapiens ]
• Official Symbol: H2AFV
• Synonyms: H2AFV; H2A histone family, member V; H2AV; histone H2A.V; MGC1947; MGC10170; MGC10831; H2A.F/Z; histone H2A.F/Z; purine-rich binding element protein B; FLJ26479
• Gene ID: 94239
• mRNA Refseq: NM_012412
• Protein Refseq: NP_036544
• UniProt ID: Q71UI9