Recombinant Human H2AFB2 Protein, GST-tagged
Cat.No. : | H2AFB2-4532H |
Product Overview : | Human H2AFB2 full-length ORF ( ADR82798.1, 1 a.a. - 115 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. This gene is part of a region that is repeated three times on chromosome X, once in intron 22 of the F8 gene and twice closer to the Xq telomere. This record represents the middle copy. [provided by RefSeq, Oct 2015] |
Molecular Mass : | 12.7 kDa |
AA Sequence : | MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVLELAGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | H2AFB2 H2A histone family member B2 [ Homo sapiens (human) ] |
Official Symbol | H2AFB2 |
Synonyms | H2AFB2; H2A histone family member B2; H2A.Bbd; histone H2A-Bbd type 2/3; H2A Barr body deficient |
Gene ID | 474381 |
mRNA Refseq | NM_001017991 |
Protein Refseq | NP_001017991 |
UniProt ID | P0C5Z0 |
◆ Recombinant Proteins | ||
H2AFB2-3400HF | Recombinant Full Length Human H2AFB2 Protein, GST-tagged | +Inquiry |
H2AFB2-4532H | Recombinant Human H2AFB2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
H2AFB2-5663HCL | Recombinant Human H2AFB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All H2AFB2 Products
Required fields are marked with *
My Review for All H2AFB2 Products
Required fields are marked with *
0
Inquiry Basket