Recombinant Full Length Human H2AFB2 Protein, GST-tagged

Cat.No. : H2AFB2-3400HF
Product Overview : Human H2AFB2 full-length ORF ( ADR82798.1, 1 a.a. - 115 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 115 amino acids
Description : Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene encodes a replication-independent histone that is a member of the histone H2A family. This gene is part of a region that is repeated three times on chromosome X, once in intron 22 of the F8 gene and twice closer to the Xq telomere. This record represents the middle copy. [provided by RefSeq, Oct 2015]
Molecular Mass : 12.7 kDa
AA Sequence : MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVLELAGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name H2AFB2 H2A histone family member B2 [ Homo sapiens (human) ]
Official Symbol H2AFB2
Synonyms H2AFB2; H2A histone family member B2; H2A.Bbd; histone H2A-Bbd type 2/3; H2A Barr body deficient
Gene ID 474381
mRNA Refseq NM_001017991
Protein Refseq NP_001017991
MIM 301038
UniProt ID P0C5Z0

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All H2AFB2 Products

Required fields are marked with *

My Review for All H2AFB2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon