Recombinant Human H1F0 Protein, GST-tagged

• Cat.No.: H1F0-4528H
• Product Overview: Human H1F0 full-length ORF ( NP_005309.1, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H1 family. [provided by RefSeq
• Molecular Mass: 47.3 kDa
• AA Sequence: MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: H1F0 H1 histone family, member 0 [ Homo sapiens ]
• Official Symbol: H1F0
• Synonyms: H1F0; H1 histone family, member 0; H1FV; histone H1.0; H1.0; H1(0); H1 0; H10; histone H1; histone H1(0); H1.0, H1(0), H1-0; MGC5241
• Gene ID: 3005
• mRNA Refseq: NM_005318
• Protein Refseq: NP_005309
• MIM: 142708
• UniProt ID: P07305