Recombinant Human H1F0 Protein, GST-tagged
Cat.No. : | H1F0-4528H |
Product Overview : | Human H1F0 full-length ORF ( NP_005309.1, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H1 family. [provided by RefSeq |
Molecular Mass : | 47.3 kDa |
AA Sequence : | MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | H1F0 H1 histone family, member 0 [ Homo sapiens ] |
Official Symbol | H1F0 |
Synonyms | H1F0; H1 histone family, member 0; H1FV; histone H1.0; H1.0; H1(0); H1 0; H10; histone H1; histone H1(0); H1.0, H1(0), H1-0; MGC5241; |
Gene ID | 3005 |
mRNA Refseq | NM_005318 |
Protein Refseq | NP_005309 |
MIM | 142708 |
UniProt ID | P07305 |
◆ Recombinant Proteins | ||
H1F0-2579H | Recombinant Human H1F0 protein(21-120 aa), C-His-tagged | +Inquiry |
H1F0-2427R | Recombinant Rat H1F0 Protein, His (Fc)-Avi-tagged | +Inquiry |
H1F0-4035M | Recombinant Mouse H1F0 Protein, His (Fc)-Avi-tagged | +Inquiry |
H1F0-7420M | Recombinant Mouse H1F0 Protein | +Inquiry |
H1F0-13640H | Recombinant Human H1F0, GST-tagged | +Inquiry |
◆ Native Proteins | ||
H1F0-01B | Native Bovine H1F0 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
H1F0-2117HCL | Recombinant Human H1F0 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All H1F0 Products
Required fields are marked with *
My Review for All H1F0 Products
Required fields are marked with *
0
Inquiry Basket