Recombinant Full Length Human H1F0 Protein, GST-tagged

Cat.No. : H1F0-3395HF
Product Overview : Human H1F0 full-length ORF ( NP_005309.1, 1 a.a. - 194 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 194 amino acids
Description : Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H1 family. [provided by RefSeq
Molecular Mass : 47.3 kDa
AA Sequence : MTENSTSAPAAKPKRAKASKKSTDHPKYSDMIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKPKTVKAKPVKASKPKKAKPVKPKAKSSAKRAGKKK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name H1F0 H1 histone family, member 0 [ Homo sapiens ]
Official Symbol H1F0
Synonyms H1F0; H1 histone family, member 0; H1FV; histone H1.0; H1.0; H1(0); H1 0; H10; histone H1; histone H1(0); H1.0, H1(0), H1-0; MGC5241;
Gene ID 3005
mRNA Refseq NM_005318
Protein Refseq NP_005309
MIM 142708
UniProt ID P07305

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All H1F0 Products

Required fields are marked with *

My Review for All H1F0 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon