Recombinant Human H1F0 protein(31-160 aa), C-His-tagged
Cat.No. : | H1F0-2578H |
Product Overview : | Recombinant Human H1F0 protein(P07305)(31-160 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 31-160 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | MIVAAIQAEKNRAGSSRQSIQKYIKSHYKVGENADSQIKLSIKRLVTTGVLKQTKGVGASGSFRLAKSDEPKKSVAFKKTKKEIKKVATPKKASKPKKAASKAPTKKPKATPVKKAKKKLAATPKKAKKP |
Gene Name | H1F0 H1 histone family, member 0 [ Homo sapiens ] |
Official Symbol | H1F0 |
Synonyms | H1F0; H1 histone family, member 0; H1FV; histone H1.0; H1.0; H1(0); H1 0; H10; histone H1; histone H1(0); H1.0, H1(0), H1-0; MGC5241; |
Gene ID | 3005 |
mRNA Refseq | NM_005318 |
Protein Refseq | NP_005309 |
MIM | 142708 |
UniProt ID | P07305 |
◆ Recombinant Proteins | ||
H1F0-2427R | Recombinant Rat H1F0 Protein, His (Fc)-Avi-tagged | +Inquiry |
H1F0-2579H | Recombinant Human H1F0 protein(21-120 aa), C-His-tagged | +Inquiry |
H1F0-4528H | Recombinant Human H1F0 Protein, GST-tagged | +Inquiry |
H1F0-13640H | Recombinant Human H1F0, GST-tagged | +Inquiry |
H1F0-2132H | Recombinant Human H1 Histone Family, Member 0 | +Inquiry |
◆ Native Proteins | ||
H1F0-01B | Native Bovine H1F0 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
H1F0-2117HCL | Recombinant Human H1F0 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All H1F0 Products
Required fields are marked with *
My Review for All H1F0 Products
Required fields are marked with *
0
Inquiry Basket