Recombinant Human GUK1 Protein, GST-tagged
Cat.No. : | GUK1-4495H |
Product Overview : | Human GUK1 full-length ORF ( AAH06249, 1 a.a. - 197 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is an enzyme that catalyzes the transfer of a phosphate group from ATP to guanosine monophosphate (GMP) to form guanosine diphosphate (GDP). The encoded protein is thought to be a good target for cancer chemotherapy. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2011] |
Molecular Mass : | 47.41 kDa |
AA Sequence : | MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENGKDYYFVTREVMQRDIAAGDFIEHAEFSGNLYGTSKVAVQAVQAMNRICVLDVDLQGVRNIKATDLRPIYISVQPPSLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKKAQRTGA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GUK1 guanylate kinase 1 [ Homo sapiens ] |
Official Symbol | GUK1 |
Synonyms | GUK1; guanylate kinase 1; guanylate kinase; GMP kinase; ATP:GMP phosphotransferase; GMK; FLJ42686; FLJ43710; |
Gene ID | 2987 |
mRNA Refseq | NM_000858 |
Protein Refseq | NP_000849 |
MIM | 139270 |
UniProt ID | Q16774 |
◆ Recombinant Proteins | ||
GUK1-4665H | Recombinant Human GUK1 protein | +Inquiry |
GUK1-4406H | Recombinant Human GUK1 protein, His-SUMO-tagged | +Inquiry |
GUK1-2785H | Recombinant Human Guanylate Kinase 1, His-tagged | +Inquiry |
GUK1-185H | Active Recombinant Human GUK1 protein, His-tagged | +Inquiry |
GUK1-3348HF | Recombinant Full Length Human GUK1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GUK1-5674HCL | Recombinant Human GUK1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GUK1 Products
Required fields are marked with *
My Review for All GUK1 Products
Required fields are marked with *
0
Inquiry Basket