Recombinant Human GUCA1A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : GUCA1A-1746H
Product Overview : GUCA1A MS Standard C13 and N15-labeled recombinant protein (NP_000400) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes an enzyme that plays a role in the recovery of retinal photoreceptors from photobleaching. This enzyme promotes the activity of retinal guanylyl cyclase-1 (GC1) at low calcium concentrations and inhibits GC1 at high calcium concentrations. Mutations in this gene can cause cone dystrophy 3 and code-rod dystrophy 14. Alternative splicing results in multiple transcript variants.
Molecular Mass : 22.9 kDa
AA Sequence : MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIRAINPCSDTTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAAGTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name GUCA1A guanylate cyclase activator 1A [ Homo sapiens (human) ]
Official Symbol GUCA1A
Synonyms GUCA1A; guanylate cyclase activator 1A (retina); C6orf131, chromosome 6 open reading frame 131, GUCA, GUCA1; guanylyl cyclase-activating protein 1; COD3; cone dystrophy 3; dJ139D8.6; GCAP; GCAP1; GCAP 1; guanylin 1, retina; guanylate cyclase-activating protein, photoreceptor 1; GUCA; GUCA1; CORD14; C6orf131;
Gene ID 2978
mRNA Refseq NM_000409
Protein Refseq NP_000400
MIM 600364
UniProt ID P43080

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GUCA1A Products

Required fields are marked with *

My Review for All GUCA1A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon