Recombinant Human GUCA1A Protein, GST-tagged

• Cat.No.: GUCA1A-4482H
• Product Overview: Human GUCA1A full-length ORF ( AAH31663, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene plays a role in the recovery of retinal photoreceptors from photobleaching. In the recovery phase, the phototransduction messeneger cGMP is replenished by retinal guanylyl cyclase-1 (GC1). GC1 is activated by decreasing Ca(2+) concentrations following photobleaching. The protein encoded by this gene, guanylyl cyclase activating protein 1 (GCAP1), mediates the sensitivity of GC1 to Ca(2+) concentrations. GCAP1 promotes activity of GC1 at low Ca(2+) concentrations and inhibits GC1 activity at high Ca(2+) concentrations. Mutations in this gene cause autosomal dominant cone dystrophy (COD3); a disease characterized by reduced visual acuity associated with progressive loss of color vision. Mutations in this gene prohibit the inactivation of RetGC1 at high Ca(2+) concentrations; causing the constitutive activation of RetGC1 and, presumably, increased cell death. This gene is expressed in retina and spermatagonia. [provided by RefSeq
• Molecular Mass: 47.85 kDa
• AA Sequence: MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIRAINPCSDTTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAAG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GUCA1A guanylate cyclase activator 1A (retina) [ Homo sapiens ]
• Official Symbol: GUCA1A
• Synonyms: GUCA1A; guanylate cyclase activator 1A (retina); C6orf131, chromosome 6 open reading frame 131 , GUCA, GUCA1; guanylyl cyclase-activating protein 1; COD3; cone dystrophy 3; dJ139D8.6; GCAP; GCAP1; GCAP 1; guanylin 1, retina; guanylate cyclase-activating protein, photoreceptor 1; GUCA; GUCA1; CORD14; C6orf131
• Gene ID: 2978
• mRNA Refseq: NM_000409
• Protein Refseq: NP_000400
• MIM: 600364
• UniProt ID: P43080