Recombinant Human GUCA1A Protein, GST-tagged
Cat.No. : | GUCA1A-4482H |
Product Overview : | Human GUCA1A full-length ORF ( AAH31663, 1 a.a. - 201 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene plays a role in the recovery of retinal photoreceptors from photobleaching. In the recovery phase, the phototransduction messeneger cGMP is replenished by retinal guanylyl cyclase-1 (GC1). GC1 is activated by decreasing Ca(2+) concentrations following photobleaching. The protein encoded by this gene, guanylyl cyclase activating protein 1 (GCAP1), mediates the sensitivity of GC1 to Ca(2+) concentrations. GCAP1 promotes activity of GC1 at low Ca(2+) concentrations and inhibits GC1 activity at high Ca(2+) concentrations. Mutations in this gene cause autosomal dominant cone dystrophy (COD3); a disease characterized by reduced visual acuity associated with progressive loss of color vision. Mutations in this gene prohibit the inactivation of RetGC1 at high Ca(2+) concentrations; causing the constitutive activation of RetGC1 and, presumably, increased cell death. This gene is expressed in retina and spermatagonia. [provided by RefSeq |
Molecular Mass : | 47.85 kDa |
AA Sequence : | MGNVMEGKSVEELSSTECHQWYKKFMTECPSGQLTLYEFRQFFGLKNLSPSASQYVEQMFETFDFNKDGYIDFMEYVAALSLVLKGKVEQKLRWYFKLYDVDGNGCIDRDELLTIIQAIRAINPCSDTTMTAEEFTDTVFSKIDVNGDGELSLEEFIEGVQKDQMLLDTLTRSLDLTRIVRRLQNGEQDEEGADEAAEAAG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GUCA1A guanylate cyclase activator 1A (retina) [ Homo sapiens ] |
Official Symbol | GUCA1A |
Synonyms | GUCA1A; guanylate cyclase activator 1A (retina); C6orf131, chromosome 6 open reading frame 131 , GUCA, GUCA1; guanylyl cyclase-activating protein 1; COD3; cone dystrophy 3; dJ139D8.6; GCAP; GCAP1; GCAP 1; guanylin 1, retina; guanylate cyclase-activating protein, photoreceptor 1; GUCA; GUCA1; CORD14; C6orf131; |
Gene ID | 2978 |
mRNA Refseq | NM_000409 |
Protein Refseq | NP_000400 |
MIM | 600364 |
UniProt ID | P43080 |
◆ Recombinant Proteins | ||
GUCA1A-3340HF | Recombinant Full Length Human GUCA1A Protein, GST-tagged | +Inquiry |
GUCA1A-9374Z | Recombinant Zebrafish GUCA1A | +Inquiry |
GUCA1A-7383M | Recombinant Mouse GUCA1A Protein | +Inquiry |
GUCA1A-1746H | Recombinant Human GUCA1A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GUCA1A-226HF | Recombinant Full Length Human GUCA1A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GUCA1A-001HCL | Recombinant Human GUCA1A cell lysate | +Inquiry |
GUCA1A-002HCL | Recombinant Human GUCA1A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GUCA1A Products
Required fields are marked with *
My Review for All GUCA1A Products
Required fields are marked with *
0
Inquiry Basket