Recombinant Human GTF2I Protein, GST-tagged
Cat.No. : | GTF2I-4454H |
Product Overview : | Human GTF2I full-length ORF ( AAH04472.1, 36 a.a. - 274 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a multifunctional phosphoprotein with roles in transcription and signal transduction. It is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at chromosome 7q11.23. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 7, 13 and 21. [provided by RefSeq |
Molecular Mass : | 52.03 kDa |
AA Sequence : | ELAKSKAEVACIAVYETDVFVVGTERGRAFVNTRKDFQKDFVKYCVEEEEKAAEMHKMKSTTQANRMSVDAVEIETLRKTVEDYFCFCYGKALGKSTVVPVPYEKMLRDQSAVVVQGLPEGVAFKHPENYDLATLKWILENKAGISFIIKRPFLEPKKHVGGRVMVTDADRSILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVKEESEDPDYYQYNIQGSHHSSEGNEGTEMEVPAEG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GTF2I general transcription factor IIi [ Homo sapiens ] |
Official Symbol | GTF2I |
Synonyms | GTF2I; general transcription factor IIi; general transcription factor II, i , WBSCR6; general transcription factor II-I; BAP 135; BTKAP1; DIWS; IB291; SPIN; TFII I; BTK-associated protein 135; BTK-associated protein, 135kD; SRF-Phox1-interacting protein; Williams-Beuren syndrome chromosome region 6; Bruton tyrosine kinase-associated protein 135; williams-Beuren syndrome chromosomal region 6 protein; WBS; BAP135; TFII-I; WBSCR6; GTFII-I; FLJ38776; FLJ56355; |
Gene ID | 2969 |
mRNA Refseq | NM_001163636 |
Protein Refseq | NP_001157108 |
MIM | 601679 |
UniProt ID | P78347 |
◆ Recombinant Proteins | ||
GTF2I-4454H | Recombinant Human GTF2I Protein, GST-tagged | +Inquiry |
GTF2I-29513TH | Recombinant Human GTF2I | +Inquiry |
GTF2I-15H | Recombinant Human GTF2I Protein (1-976), N-GST-tagged | +Inquiry |
GTF2I-2745R | Recombinant Rat GTF2I Protein | +Inquiry |
GTF2I-1831R | Recombinant Rhesus Macaque GTF2I Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GTF2I-763HCL | Recombinant Human GTF2I cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GTF2I Products
Required fields are marked with *
My Review for All GTF2I Products
Required fields are marked with *
0
Inquiry Basket