Recombinant Human GSX1 Protein, GST-tagged

• Cat.No.: GSX1-4434H
• Product Overview: Human GSX1 full-length ORF ( AAI60140.1, 1 a.a. - 264 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: GSX1 (GS Homeobox 1) is a Protein Coding gene. GO annotations related to this gene include sequence-specific DNA binding and transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding. An important paralog of this gene is GSX2.
• Molecular Mass: 29.1 kDa
• AA Sequence: MPRSFLVDSLVLREAGEKKAPEGSPPPLFPYAVPPPHALHGLSPGACHARKAGLLCVCPLCVTASQLHGPPGPPALPLLKASFPPFGSQYCHAPLGRQHSAVSPGVAHGPAAAAAAAALYQTSYPLPDPRQFHCISVDSSSNQLPSSKRMRTAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKGSNHRGGGGGGAGGGGSAPQGCKCASLSSAKCSEDDDELPMSPSSSGKDDRDLTVTP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GSX1 GS homeobox 1 [ Homo sapiens (human) ]
• Official Symbol: GSX1
• Synonyms: GS Homeobox 1; GSH1; Genomic Screened Homeo Box 1; GS Homeo Box Protein 1; Homeobox Protein Gsh-1; Homeobox Protein GSH-1; Gsh-1; GSX1; GS homeobox 1; GS homeo box protein 1; genomic screened homeo box 1; homeobox protein Gsh-1
• Gene ID: 219409
• mRNA Refseq: NM_145657
• Protein Refseq: NM_145657
• MIM: 616542
• UniProt ID: Q9H4S2