Recombinant Full Length Human GSX1 Protein, GST-tagged

Cat.No. : GSX1-3371HF
Product Overview : Human GSX1 full-length ORF ( AAI60140.1, 1 a.a. - 264 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 264 amino acids
Description : GSX1 (GS Homeobox 1) is a Protein Coding gene. GO annotations related to this gene include sequence-specific DNA binding and transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding. An important paralog of this gene is GSX2.
Molecular Mass : 29.1 kDa
AA Sequence : MPRSFLVDSLVLREAGEKKAPEGSPPPLFPYAVPPPHALHGLSPGACHARKAGLLCVCPLCVTASQLHGPPGPPALPLLKASFPPFGSQYCHAPLGRQHSAVSPGVAHGPAAAAAAAALYQTSYPLPDPRQFHCISVDSSSNQLPSSKRMRTAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKGSNHRGGGGGGAGGGGSAPQGCKCASLSSAKCSEDDDELPMSPSSSGKDDRDLTVTP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GSX1 GS homeobox 1 [ Homo sapiens (human) ]
Official Symbol GSX1
Synonyms GS Homeobox 1; GSH1; Genomic Screened Homeo Box 1; GS Homeo Box Protein 1; Homeobox Protein Gsh-1; Homeobox Protein GSH-1; Gsh-1; GSX1; GS homeobox 1; GS homeo box protein 1; genomic screened homeo box 1; homeobox protein Gsh-1
Gene ID 219409
mRNA Refseq NM_145657
Protein Refseq NM_145657
MIM 616542
UniProt ID Q9H4S2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GSX1 Products

Required fields are marked with *

My Review for All GSX1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon