Recombinant Human GSTZ1 Protein, GST-tagged

Cat.No. : GSTZ1-4432H
Product Overview : Human GSTZ1 full-length ORF ( AAH01453, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene is a member of the glutathione S-transferase (GSTs) super-family which encodes multifunctional enzymes important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme also plays a significant role in the catabolism of phenylalanine and tyrosine. Thus defects in this enzyme may lead to severe metabolic disorders including alkaptonuria, phenylketonuria and tyrosinaemia. Several transcript variants of this gene encode multiple protein isoforms. [provided by RefSeq
Molecular Mass : 49.50 kDa
AA Sequence : MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GSTZ1 glutathione transferase zeta 1 [ Homo sapiens ]
Official Symbol GSTZ1
Synonyms GSTZ1; glutathione transferase zeta 1; maleylacetoacetate isomerase; GSTZ1 1; MAAI; MAI; maleylacetone isomerase; glutathione S-aryltransferase; glutathione S-alkyltransferase; glutathione S-aralkyltransferase; glutathione s-transferase Zeta 1; S-(hydroxyalkyl)glutathione lyase; GSTZ1-1; MGC2029;
Gene ID 2954
mRNA Refseq NM_001513
Protein Refseq NP_001504
MIM 603758
UniProt ID O43708

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GSTZ1 Products

Required fields are marked with *

My Review for All GSTZ1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon