Recombinant Full Length Human GSTZ1 Protein, GST-tagged

• Cat.No.: GSTZ1-3370HF
• Product Overview: Human GSTZ1 full-length ORF ( AAH01453, 1 a.a. - 216 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 216 amino acids
• Description: This gene is a member of the glutathione S-transferase (GSTs) super-family which encodes multifunctional enzymes important in the detoxification of electrophilic molecules, including carcinogens, mutagens, and several therapeutic drugs, by conjugation with glutathione. This enzyme also plays a significant role in the catabolism of phenylalanine and tyrosine. Thus defects in this enzyme may lead to severe metabolic disorders including alkaptonuria, phenylketonuria and tyrosinaemia. Several transcript variants of this gene encode multiple protein isoforms. [provided by RefSeq
• Molecular Mass: 49.50 kDa
• AA Sequence: MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GSTZ1 glutathione transferase zeta 1 [ Homo sapiens ]
• Official Symbol: GSTZ1
• Synonyms: GSTZ1; glutathione transferase zeta 1; maleylacetoacetate isomerase; GSTZ1 1; MAAI; MAI; maleylacetone isomerase; glutathione S-aryltransferase; glutathione S-alkyltransferase; glutathione S-aralkyltransferase; glutathione s-transferase Zeta 1; S-(hydroxyalkyl)glutathione lyase; GSTZ1-1; MGC2029
• Gene ID: 2954
• mRNA Refseq: NM_001513
• Protein Refseq: NP_001504
• MIM: 603758
• UniProt ID: O43708