Recombinant Human GSTO2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | GSTO2-3229H |
Product Overview : | GSTO2 MS Standard C13 and N15-labeled recombinant protein (NP_899062) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is an omega class glutathione S-transferase (GST). GSTs are involved in the metabolism of xenobiotics and carcinogens. Four transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 28.3 kDa |
AA Sequence : | MSGDATRTLGKGSQPPGPVPEGLIRIYSMRFCPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYYTKHPFGHIPVLETSQCQLIYESVIACEYLDDAYPGRKLFPYDPYERARQKMLLELFCKVPHLTKECLVALRCGRECTNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDFGLCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | GSTO2 glutathione S-transferase omega 2 [ Homo sapiens (human) ] |
Official Symbol | GSTO2 |
Synonyms | GSTO2; glutathione S-transferase omega 2; glutathione S-transferase omega-2; GSTO-2; MMA(V) reductase; monomethylarsonic acid reductase; glutathione S-transferase omega 2-2; glutathione-S-transferase-like protein; bA127L20.1 (novel glutathione-S-transferase); glutathione-dependent dehydroascorbate reductase; GSTO 2-2; bA127L20.1; |
Gene ID | 119391 |
mRNA Refseq | NM_183239 |
Protein Refseq | NP_899062 |
MIM | 612314 |
UniProt ID | Q9H4Y5 |
◆ Recombinant Proteins | ||
GSTO2-1759Z | Recombinant Zebrafish GSTO2 | +Inquiry |
GSTO2-3229H | Recombinant Human GSTO2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GSTO2-1817R | Recombinant Rhesus Macaque GSTO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GSTO2-15855H | Recombinant Human GSTO2, His-tagged | +Inquiry |
GSTO2-1996R | Recombinant Rhesus monkey GSTO2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSTO2-5710HCL | Recombinant Human GSTO2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GSTO2 Products
Required fields are marked with *
My Review for All GSTO2 Products
Required fields are marked with *
0
Inquiry Basket