Recombinant Human GSK3B protein, His-tagged

• Cat.No.: GSK3B-416H
• Product Overview: Recombinant Human GSK3B protein(NP_001139628)(355-433 aa), fused to His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
• Protein length: 355-433 aa
• AA Sequence: ELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
  If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
  Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.

Gene Information

• Gene Name: GSK3B glycogen synthase kinase 3 beta [ Homo sapiens ]
• Official Symbol: GSK3B
• Synonyms: GSK3B; glycogen synthase kinase 3 beta; glycogen synthase kinase-3 beta; GSK-3 beta; GSK3beta isoform; serine/threonine-protein kinase GSK3B
• Gene ID: 2932
• mRNA Refseq: NM_001146156
• Protein Refseq: NP_001139628
• MIM: 605004
• UniProt ID: P49841