Recombinant Human GSK3B protein, His-tagged
Cat.No. : | GSK3B-416H |
Product Overview : | Recombinant Human GSK3B protein(NP_001139628)(355-433 aa), fused to His tag, was expressed in E. coli. |
Availability | April 20, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 355-433 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | ELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASASNST |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | GSK3B glycogen synthase kinase 3 beta [ Homo sapiens ] |
Official Symbol | GSK3B |
Synonyms | GSK3B; glycogen synthase kinase 3 beta; glycogen synthase kinase-3 beta; GSK-3 beta; GSK3beta isoform; serine/threonine-protein kinase GSK3B; |
Gene ID | 2932 |
mRNA Refseq | NM_001146156 |
Protein Refseq | NP_001139628 |
MIM | 605004 |
UniProt ID | P49841 |
◆ Recombinant Proteins | ||
Gsk3b-3318M | Recombinant Mouse Gsk3b Protein, Myc/DDK-tagged | +Inquiry |
Gsk3b-1603R | Recombinant Rat Gsk3b Protein, His-tagged | +Inquiry |
GSK3B-193H | Recombinant Human GSK3B protein, His-tagged | +Inquiry |
GSK3B-3329HF | Recombinant Full Length Human GSK3B Protein, GST-tagged | +Inquiry |
GSK3B-616H | Active Recombinant Human GSK3B protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSK3B-717HCL | Recombinant Human GSK3B cell lysate | +Inquiry |
GSK3B-534MCL | Recombinant Mouse GSK3B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GSK3B Products
Required fields are marked with *
My Review for All GSK3B Products
Required fields are marked with *
0
Inquiry Basket