Recombinant Human Growth Hormone 1, His-tagged

Cat.No. : GH1-382H
Product Overview : RecombinantHuman GH1 is a protein composed of 22.9 kDa, 205 amino residues and itcontains a 6-His-tag at the N-terminal end and is purified by sequentialchromatography.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Tag : His
Description : GH1 is a member ofthe somatotropin / prolactin family of hormones which play an important rolein growth control.
Form : Lyophilized from aPBS 0.05M buffer at pH 7.5.
Purity : > 97% by SDS-PAGEgel
M.W : 22.9 kDa
Endotoxin Level : < 0.04 EU/μgprotein (LAL method)
Sequence : HHHHHHFPTIPLSRPFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREE TQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIF KQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGFAG
p.I : 5.98
Extinction coeff : E0.1% = 0.77 (A 280nm)
Reconstitution Recommendation : Lyophilized proteinshould be reconstituted in water to a concentration of 50 ng/μl.
Biological Activity : ED50 ≤ 0.04-0.1ng/mL. The biologica activity of human Growth Hormone is measured by cellproliferation using Nb2-11 cells.
Storage : This lyophilizedpreparation is stable at 2-8ºC. For long storage should be kept at -20ºC andit is recommended to add a carrier protein (0.1% HAS or BSA). Repeatedfreezing and thawing is not recommended.
OfficialSymbol : GH1
Pathways : Adipogenesis;Cytokine Signaling in Immune system; Cytokine-cytokine receptor interaction;Diabetes pathways; Endochondral Ossification; Growth hormone receptorsignaling; Immune System; Jak-STAT signaling pathway; Neuroactiveligand-receptor interaction; Synthesis, Secretion, and Deacylation of Ghrelin
Gene Name GH1 growth hormone 1 [ Homosapiens ]
Synonyms GH1;growth hormone 1; GH; GHN; GH-N; hGH-N; IGHD1B; somatotropin; pituitarygrowth hormone; Somatotropin; Growth hormone; Growth hormone 1; Pituitarygrowth hormone
Gene ID 2688
mRNA Refseq NM_000515
Protein Refseq NP_000506
MIM 139250
UniProt ID P01241
Chromosome Location 17q22-q24
Function growth factoractivity; growth hormone receptor binding; hormone activity; metal ionbinding; prolactin receptor binding; protein binding

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GH1 Products

Required fields are marked with *

My Review for All GH1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon