Recombinant Human Growth Hormone 1, His-tagged

• Cat.No.: GH1-382H
• Product Overview: RecombinantHuman GH1 is a protein composed of 22.9 kDa, 205 amino residues and itcontains a 6-His-tag at the N-terminal end and is purified by sequentialchromatography.

Specification

• Cat. No.: GH1-382H
• Description: GH1 is a member ofthe somatotropin / prolactin family of hormones which play an important rolein growth control.
• Source: Nicotianabenthamiana. Produced by transien texpression of human Growth Hormone innon-transgenic plants.
• Species: Human
• Form: Lyophilized from aPBS 0.05M buffer at pH 7.5.
• Purity: > 97% by SDS-PAGEgel
• M.W: 22.9 kDa
• Endotoxin Level: < 0.04 EU/μgprotein (LAL method)
• Sequence: HHHHHHFPTIPLSRPFDNAMLRAHRLHQLAFDTYQEFEEAYIPKEQKYSFLQNPQTSLCFSESIPTPSNREE TQQKSNLELLRISLLLIQSWLEPVQFLRSVFANSLVYGASDSNVYDLLKDLEEGIQTLMGRLEDGSPRTGQIF KQTYSKFDTNSHNDDALLKNYGLLYCFRKDMDKVETFLRIVQCRSVEGSCGFAG
• p.I: 5.98
• Extinction coeff: E0.1% = 0.77 (A 280nm)
• Reconstitution Recommendation: Lyophilized proteinshould be reconstituted in water to a concentration of 50 ng/μl.
• Biological Activity: ED50 ≤ 0.04-0.1ng/mL. The biologica activity of human Growth Hormone is measured by cellproliferation using Nb2-11 cells.
• Storage: This lyophilizedpreparation is stable at 2-8ºC. For long storage should be kept at -20ºC andit is recommended to add a carrier protein (0.1% HAS or BSA). Repeatedfreezing and thawing is not recommended.
• OfficialSymbol: GH1
• Pathways: Adipogenesis;Cytokine Signaling in Immune system; Cytokine-cytokine receptor interaction;Diabetes pathways; Endochondral Ossification; Growth hormone receptorsignaling; Immune System; Jak-STAT signaling pathway; Neuroactiveligand-receptor interaction; Synthesis, Secretion, and Deacylation of Ghrelin

Gene Information

• Gene Name: GH1 growth hormone 1 [ Homosapiens ]
• Synonyms: GH1;growth hormone 1; GH; GHN; GH-N; hGH-N; IGHD1B; somatotropin; pituitarygrowth hormone; Somatotropin; Growth hormone; Growth hormone 1; Pituitarygrowth hormone
• Gene ID: 2688
• mRNA Refseq: NM_000515
• Protein Refseq: NP_000506
• MIM: 139250
• UniProt ID: P01241
• Chromosome Location: 17q22-q24
• Function: growth factoractivity; growth hormone receptor binding; hormone activity; metal ionbinding; prolactin receptor binding; protein binding