Recombinant Human GRM8 Protein, GST-tagged

• Cat.No.: GRM8-5374H
• Product Overview: Human GRM8 partial ORF ( NP_000836, 486 a.a. - 575 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: L-glutamate is the major excitatory neurotransmitter in the central nervous system and activates both ionotropic and metabotropic glutamate receptors. Glutamatergic neurotransmission is involved in most aspects of normal brain function and can be perturbed in many neuropathologic conditions. The metabotropic glutamate receptors are a family of G protein-coupled receptors, that have been divided into 3 groups on the basis of sequence homology, putative signal transduction mechanisms, and pharmacologic properties. Group I includes GRM1 and GRM5 and these receptors have been shown to activate phospholipase C. Group II includes GRM2 and GRM3 while Group III includes GRM4, GRM6, GRM7 and GRM8. Group II and III receptors are linked to the inhibition of the cyclic AMP cascade but differ in their agonist selectivities. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 35.64 kDa
• AA Sequence: KVIGHWTNQLHLKVEDMQWAHREHTHPASVCSLPCKPGERKKTVKGVPCCWHCERCEGYNYQVDELSCELCPLDQRPNMNRTGCQLIPII
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GRM8 glutamate receptor, metabotropic 8 [ Homo sapiens ]
• Official Symbol: GRM8
• Synonyms: GRM8; glutamate receptor, metabotropic 8; metabotropic glutamate receptor 8; GLUR8; GPRC1H; mGlu8; MGLUR8; FLJ41058; MGC126724
• Gene ID: 2918
• mRNA Refseq: NM_000845
• Protein Refseq: NP_000836
• MIM: 601116
• UniProt ID: O00222