Recombinant Human GRK5 Protein, GST-tagged

• Cat.No.: GRK5-5356H
• Product Overview: Human GRK5 partial ORF ( AAH64506, 51 a.a. - 150 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs). [provided by RefSeq
• Molecular Mass: 36.63 kDa
• AA Sequence: RDYCSLCDKQPIGRLLFRQFCETRPGLECYIQFLDSVAEYEVTPDEKLGEKGKEIMTKYLTPKSPVFIAQVGQDLVSQTEEKLLQKPCKELFSACAQSVH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GRK5 G protein-coupled receptor kinase 5 [ Homo sapiens ]
• Official Symbol: GRK5
• Synonyms: GRK5; G protein-coupled receptor kinase 5; GPRK5; FP2025; g protein-coupled receptor kinase GRK5; FLJ39780
• Gene ID: 2869
• mRNA Refseq: NM_005308
• Protein Refseq: NP_005299
• MIM: 600870
• UniProt ID: P34947