Recombinant Human GRIK4 Protein, GST-tagged

Cat.No. : GRIK4-5340H
Product Overview : Human GRIK4 partial ORF ( NP_055434, 21 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein that belongs to the glutamate-gated ionic channel family. Glutamate functions as the major excitatory neurotransmitter in the central nervous system through activation of ligand-gated ion channels and G protein-coupled membrane receptors. The protein encoded by this gene forms functional heteromeric kainate-preferring ionic channels with the subunits encoded by related gene family members. [provided by RefSeq
Molecular Mass : 37.84 kDa
AA Sequence : SPHSLRIAAILDDPMECSRGERLSITLAKNRINRAPERLGKAKVEVDIFELLRDSEYETAETMCQILPKGVVAVLGPSSSPASSSIISNICGEKEVPHFKVAPEEFVKFQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GRIK4 glutamate receptor, ionotropic, kainate 4 [ Homo sapiens ]
Official Symbol GRIK4
Synonyms GRIK4; glutamate receptor, ionotropic, kainate 4; GRIK; glutamate receptor, ionotropic kainate 4; GluK4; KA1; glutamate receptor KA1; glutamate receptor KA-1; excitatory amino acid receptor 1; EAA1;
Gene ID 2900
mRNA Refseq NM_014619
Protein Refseq NP_055434
MIM 600282
UniProt ID Q16099

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GRIK4 Products

Required fields are marked with *

My Review for All GRIK4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon