Recombinant Human GRID2 Protein, GST-tagged
Cat.No. : | GRID2-5335H |
Product Overview : | Human GRID2 partial ORF ( NP_001501, 908 a.a. - 1007 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Human glutamate receptor delta-2 (GRID2) is a relatively new member of the family of ionotropic glutamate receptors which are the predominant excitatory neurotransmitter receptors in the mammalian brain. GRID2 is a predicted 1,007 amino acid protein that shares 97% identity with the mouse homolog which is expressed selectively in cerebellar Purkinje cells. A point mutation in mouse GRID2, associated with the phenotype named lurcher, in the heterozygous state leads to ataxia resulting from selective, cell-autonomous apoptosis of cerebellar Purkinje cells during postnatal development. Mice homozygous for this mutation die shortly after birth from massive loss of mid- and hindbrain neurons during late embryogenesis. This strongly suggests a role for GRID2 in neuronal apoptotic death. [provided by RefSeq |
Molecular Mass : | 36.74 kDa |
AA Sequence : | DTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGNVPEHRTGPFRHRAPNGGFFRSPIKTMSSIPYQPTPTLGLNLGNDPDRGTSI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GRID2 glutamate receptor, ionotropic, delta 2 [ Homo sapiens ] |
Official Symbol | GRID2 |
Synonyms | GRID2; glutamate receptor, ionotropic, delta 2; glutamate receptor delta-2 subunit; GluD2; GluR delta 2; GluR-delta-2; gluR delta-2 subunit; MGC117022; MGC117023; MGC117024; |
Gene ID | 2895 |
mRNA Refseq | NM_001510 |
Protein Refseq | NP_001501 |
MIM | 602368 |
UniProt ID | O43424 |
◆ Recombinant Proteins | ||
GRID2-1232Z | Recombinant Zebrafish GRID2 | +Inquiry |
GRID2-2693R | Recombinant Rat GRID2 Protein | +Inquiry |
GRID2-13530H | Recombinant Human GRID2, His-tagged | +Inquiry |
GRID2-5335H | Recombinant Human GRID2 Protein, GST-tagged | +Inquiry |
GRID2-7261M | Recombinant Mouse GRID2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GRID2 Products
Required fields are marked with *
My Review for All GRID2 Products
Required fields are marked with *
0
Inquiry Basket