Recombinant Human GRIA4 protein(731-800 aa), C-His-tagged

• Cat.No.: GRIA4-2770H
• Product Overview: Recombinant Human GRIA4 protein(P48058)(731-800 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 731-800 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: NEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGECGPKDS
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: GRIA4 glutamate receptor, ionotropic, AMPA 4 [ Homo sapiens ]
• Official Symbol: GRIA4
• Synonyms: GRIA4; glutamate receptor, ionotropic, AMPA 4; GLUR4, glutamate receptor, ionotrophic, AMPA 4; glutamate receptor 4; GluA4; GLURD; gluR-4; gluR-D; AMPA-selective glutamate receptor 4; glutamate receptor, ionotrophic, AMPA 4; GLUR4; GLUR4C
• Gene ID: 2893
• mRNA Refseq: NM_000829
• Protein Refseq: NP_000820
• MIM: 138246
• UniProt ID: P48058